y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna31035.1-v1.0-hybrid
FamilyCE8
Protein PropertiesLength: 292 Molecular Weight: 31816.6 Isoelectric Point: 5.1079
ChromosomeChromosome/Scaffold: 1 Start: 2230400 End: 2231363
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE8121195e-35
  FVVAKDGSANFTTISDAIKAAPNYSSKRINIKVMAGVYNEYIIVGKEKSNLTIIGEGIDKTVISGSRSNATGFRTHDSATVEVQGYGFTAKYLTIENTAG
  PGEQAVSL
CE81212730
  KCEIYGTVDFIFGNAQVVFQRSNVYARKPVQGQFITITAQGKETSSDTSGTVFQNCTFRATSELINSGFRVDAYLGRPWQAYSTTIIMQSFLESFIDPTG
  WLDWDGRSSSAGLFYAEYANQGPGANTTSRVNWKEYKVLNSSEASNFTIRSFI
Full Sequence
Protein Sequence     Length: 292     Download
MWAAMGQDEI GFVVAKDGSA NFTTISDAIK AAPNYSSKRI NIKVMAGVYN EYIIVGKEKS    60
NLTIIGEGID KTVISGSRSN ATGFRTHDSA TVEVQGYGFT AKYLTIENTA GPGEQAVSLL    120
KCEIYGTVDF IFGNAQVVFQ RSNVYARKPV QGQFITITAQ GKETSSDTSG TVFQNCTFRA    180
TSELINSGFR VDAYLGRPWQ AYSTTIIMQS FLESFIDPTG WLDWDGRSSS AGLFYAEYAN    240
QGPGANTTSR VNWKEYKVLN SSEASNFTIR SFIIGDQWLP STGVPYDPNL I*            300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02745PLN027454.0e-8813285304+
PLN02468PLN024681.0e-8913290309+
PLN02416PLN024162.0e-9413287306+
PLN02713PLN027131.0e-10513291313+
pfam01095Pectinesterase6.0e-11813276296+
Gene Ontology
GO TermDescription
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A01329010319A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A0132866311B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB3uw0_A0.00000000032224544335A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
PDB2ntq_B0.00000009132817340A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
PDB2ntq_A0.00000009132817340A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
Hydropathy
Orthologous Group
SpeciesID
Cucumis sativusCucsa.327180.1.15.137Cucsa.327180.1.15.137
Fragaria vescamrna31035.1-v1.0-hybrid.12.119mrna31035.1-v1.0-hybrid.12.119
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny