y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna31360.1-v1.0-hybrid
FamilyGT48
Protein PropertiesLength: 1554 Molecular Weight: 178725 Isoelectric Point: 7.0645
ChromosomeChromosome/Scaffold: 5 Start: 14574896 End: 14590758
Descriptionglucan synthase-like 4
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT4881810640
  IPSNLEARRRISFFATSLFMNMPGAPKVANMVPFSVMTPHYLEDINFSKEELHSSQREVSIIFYMQKIFPDEWKNFLERMGYENLDELERDKQEELRNWA
  SFRGQTLSRTVRGMMYYREALKLQAFLDMAEDEDILEGYDAVESRNHPLSAQLDALADMKFTYVVTCQLYPSLRVAYVEEKEEIVDNKPHKVYSSVLVKA
  IPDFGDQEIYRIKLPGPPTIGEGKPENQNHGIIFTRGEALQTIDMNQ
GT48110913200
  GLNQISKFEAKVANGNSEQTISRDIFRLGRQFDFFRMLSCYFTTIGFYFSSLISVIGIYVFLYGQLYLVLSGLEKALVIEARLQNIQSLETALASQSFIQ
  LGLLTGMPMVMEIGLEKGFLNALKDFVLMQLQLASVFFTFSFGTKIHYYGRTIMHGGAKYRPTGRKVVVFHTSFTENYRLYSRSHFVKGFELLLLLIVYD
  LFRRSYESSMAW
Full Sequence
Protein Sequence     Length: 1554     Download
MSEIVVAEPI YDGGAEEKRP ITRYLTMGSG SDHNHVPEPF ESERLPATLA SKIQSFLRVA    60
NLIESEEPRI AYLCRFHAFE IAHNMDRHSN GRGVRQFKTT LLQRLEQDEE TTFRKRKEKS    120
DIRELRRVYH AYKEYIIKHE GAFNTENSHR EKLINARIIG SVLFEVLKTV SNTAGPQALA    180
NRGGIQTKPN DLFGIYNILP LDQGGAQQAI MQLPEIKAAV AAIRHIRGIP SNEDFQKHGN    240
FIDLFDFLQY CFGFQEGNVA NQREHLLLLL ANIHRRKTQK QTSVSKMAYE LHGMLTGAVS    300
LTTWEKVMPA YGGQSESFLN NVVTPIYGVI REEAKKSKGG TADHSTWRNY DDLNEYFWSP    360
DCFEIGWPMH LDHDFFCIHS PKKSNAKKAS ASTAPVEERR KEDGEEDEVG VTKEEVREPK    420
WLGKTNFVEV RSFWQIFRSF DRMWSFFIVS LQALIIMACH EVESPLQLFD KVIFEDIMSI    480
FITSAFLKFI QVAIYLMTNA VEMVLFLVPS VRKYIEISNY RICTILSWWT QVYFMDTQIW    540
YSVFCTIFGG VYGILHHLGE SLSFQVSKSE KNGLAKFVLV WNQIINSFRL EDLINNRELD    600
LMTMPMSSEL FSGIVRWPVF LLANKFSTAL SIAKDFVGRD ESLIRKLKKD EYMYCAVKEC    660
YESLKYVLEI LIIGDLEKRI VSAILTEIEK SIAKSSLLED FRMIKVPDLL AKCIELIELL    720
VEGNEDHHGK VAKVLQDIFE LVTNDMMTSG FRILELLDSS QQTETDSAYF SGNIESPLFG    780
SAGGRNSIHF PLPDSAALNE QIKRFLLLLT VQDTAMDIPS NLEARRRISF FATSLFMNMP    840
GAPKVANMVP FSVMTPHYLE DINFSKEELH SSQREVSIIF YMQKIFPDEW KNFLERMGYE    900
NLDELERDKQ EELRNWASFR GQTLSRTVRG MMYYREALKL QAFLDMAEDE DILEGYDAVE    960
SRNHPLSAQL DALADMKFTY VVTCQLYPSL RVAYVEEKEE IVDNKPHKVY SSVLVKAIPD    1020
FGDQEIYRIK LPGPPTIGEG KPENQNHGII FTRGEALQTI DMNQGFCKCI MVPYIFLHTA    1080
VYLLLHGSCL IKRPALSPLV KGFLPILSGL NQISKFEAKV ANGNSEQTIS RDIFRLGRQF    1140
DFFRMLSCYF TTIGFYFSSL ISVIGIYVFL YGQLYLVLSG LEKALVIEAR LQNIQSLETA    1200
LASQSFIQLG LLTGMPMVME IGLEKGFLNA LKDFVLMQLQ LASVFFTFSF GTKIHYYGRT    1260
IMHGGAKYRP TGRKVVVFHT SFTENYRLYS RSHFVKGFEL LLLLIVYDLF RRSYESSMAW    1320
DKIVDDWKDW NKWIRQQGGI GVQQEKSWQS WWIDEQDHLR HSGMTSRLFE ILLSVRFFLY    1380
QYGLVYHLDI SQNSTNFLVY LLSWIVILVV FLLVKAVNLG RQQFSARYHL VFRLFKATLF    1440
LGVLSIIISL SLVCHLSWRD LVVCCLAFLP TGWGLILFAQ AVRPLIENTG LWEFTRVLAK    1500
TYDYGMGVVL FAPIAVLAWL PIISAFQTRF LFNEAFNRHL QIQPILQGKK KNR*          1560
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04652DUF6058.0e-55110858+
pfam14288FKS1_dom18.0e-3028636985+
pfam02364Glucan_synthase6.0e-5311091431385+
pfam02364Glucan_synthase1.0e-568181064304+
Gene Ontology
GO TermDescription
GO:00001481,3-beta-D-glucan synthase complex
GO:00038431,3-beta-D-glucan synthase activity
GO:0006075(1->3)-beta-D-glucan biosynthetic process
GO:0016020membrane
Transmembrane Domains
StartEnd
489511
539558
10691091
11531175
12361258
13971419
14341456
14611482
15041526
Hydropathy