y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna31442.1-v1.0-hybrid
FamilyGH77
Protein PropertiesLength: 333 Molecular Weight: 37600.3 Isoelectric Point: 9.9534
ChromosomeChromosome/Scaffold: 1 Start: 13861093 End: 13863501
Descriptiondisproportionating enzyme
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH77153230
  STAINLFIAEQFLFQRQWQRVRKYAQLKGISIMGDMPIYVGYHSADVWANRKHFLLNRKGYPLLVSGVPPDAFSETGQLWGSPLYDWKAMEKEGFSWWIR
  RIRRAQNIYDAFRIDHFRGLAGFWAVPSEAKVAMVGKWKAGPGKSFFDAIFRAVGKTNIIAEDLGVITEDVIQLRKSIGAPGMAVLQFGFGSDAANPHLP
  HNHERNQVVYTGTHDNDTIRGWWDVLPQKEKSNVLKYLSIHEEEGISWAMIKGALSSVAQTAIMPMQDILRLGSSARMNIPATQFGNWGWRMPSSVTFDS
  LETEALQLK
Full Sequence
Protein Sequence     Length: 333     Download
MFQAGLKTLL TLLQSTAINL FIAEQFLFQR QWQRVRKYAQ LKGISIMGDM PIYVGYHSAD    60
VWANRKHFLL NRKGYPLLVS GVPPDAFSET GQLWGSPLYD WKAMEKEGFS WWIRRIRRAQ    120
NIYDAFRIDH FRGLAGFWAV PSEAKVAMVG KWKAGPGKSF FDAIFRAVGK TNIIAEDLGV    180
ITEDVIQLRK SIGAPGMAVL QFGFGSDAAN PHLPHNHERN QVVYTGTHDN DTIRGWWDVL    240
PQKEKSNVLK YLSIHEEEGI SWAMIKGALS SVAQTAIMPM QDILRLGSSA RMNIPATQFG    300
NWGWRMPSSV TFDSLETEAL QLKDMLSMYG RL*                                 360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR00217malQ2.0e-8715331320+
COG1640MalQ4.0e-10025331321+
pfam02446Glyco_hydro_777.0e-1363329337+
PRK14508PRK145082.0e-17015332319+
PLN02635PLN02635014332319+
Gene Ontology
GO TermDescription
GO:00041344-alpha-glucanotransferase activity
GO:0005975carbohydrate metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1x1n_A018332210524A Chain A, Structure Determination And Refinement At 1.8 A Resolution Of Disproportionating Enzyme From Potato
PDB1fp9_A011306177477A Chain A, Structure Determination And Refinement At 1.8 A Resolution Of Disproportionating Enzyme From Potato
PDB1fp8_A011306177477A Chain A, Structure Of The Amylomaltase From Thermus Thermophilus Hb8 In Space Group P21212
PDB1esw_A011306177477A Chain A, Structure Of The Amylomaltase From Thermus Thermophilus Hb8 In Space Group P21212
PDB1cwy_A011306177477A Chain A, Crystal Structure Of Amylomaltase From Thermus Aquaticus, A Glycosyltransferase Catalysing The Production Of Large Cyclic Glucans
Signal Peptide
Cleavage Site
17
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00493.1Aquca_014_00493.2Aquca_009_00054.2Aquca_009_00054.1Aquca_009_00054.3.267.859
Arabidopsis lyrata496706483146
Arabidopsis thalianaAT5G64860.1AT2G40840.1
Brachypodium distachyonBradi1g20790.1Bradi1g18650.1.259.907
Brassica rapaBra037799Bra004590
Carica papayaevm.model.supercontig_196.11evm.model.supercontig_92.60
Capsella rubellaCarubv10026154mCarubv10022587m
Chlamydomonas reinhardtiiCre03.g181500.t1.2g1899.t1
Citrus clementinaCiclev10025236mCiclev10025748mCiclev10025303m.221.544Ciclev10025303m.221.544Ciclev10025303m.94.221
Ciclev10025303m.94.221Ciclev10010989m.279.926
Citrus sinensisorange1.1g007886morange1.1g009906morange1.1g002052m.279.926orange1.1g002050m.279.926orange1.1g002027m.279.929
Cucumis sativusCucsa.250500.2Cucsa.250500.1Cucsa.250500.10
Eucalyptus grandisEucgr.I00325.1Eucgr.K01679.1.272.918
Fragaria vescamrna31443.1-v1.0-hybridmrna00258.1-v1.0-hybrid.543.676mrna00258.1-v1.0-hybrid.543.676
Glycine maxGlyma04g39730.1Glyma06g15140.1Glyma03g27600.1.272.920Glyma19g30580.1.272.920
Gossypium raimondiiGorai.003G047100.1Gorai.003G047100.2Gorai.003G047100.3Gorai.003G047100.4Gorai.010G128900.7.272.586
Gorai.010G128900.6.272.586Gorai.010G128900.3Gorai.010G128900.5Gorai.010G128900.4Gorai.010G128900.2
Gorai.010G128900.1
Linum usitatissimumLus10035845Lus10036626Lus10035408.186.791Lus10031010.709.828Lus10031010.709.828
Lus10031010.709.828Lus10031010.348.710Lus10031010.348.710Lus10031010.348.710Lus10031010.186.329
Lus10031010.186.329Lus10031010.186.329
Malus domesticaMDP0000243418.304.467MDP0000243418.304.467MDP0000243418.154.302MDP0000243418.154.302MDP0000149290.248.921
Manihot esculentacassava4.1_008552mcassava4.1_001086m.256.903
Medicago truncatulaMedtr3g094840.1Medtr7g088740.3Medtr7g088740.1.278.801Medtr7g088740.1.278.801Medtr7g088740.2.57.569
Medtr7g088740.2.57.569Medtr7g088740.2.581.734Medtr7g088740.2.581.734Medtr7g088740.1.813.966Medtr7g088740.1.813.966
Mimulus guttatusmgv1a004209m.70.300mgv1a004209m.70.300mgv1a004209m.302.523mgv1a004209m.302.523mgv1a000923m.250.897
Oryza sativaLOC_Os07g43390.1LOC_Os07g46790.1.269.917
Panicum virgatumPavirv00011352mPavirv00008161mPavirv00039603mPavirv00069371m.297.611Pavirv00070133m
Pavirv00069370m.297.826Pavirv00069369m.272.920
Physcomitrella patensPp1s44_268V6.1Pp1s117_77V6.1Pp1s8_30V6.1Pp1s253_27V6.1
Phaseolus vulgarisPhvul.009G139500.1Phvul.001G117700.1
Picea abiesMA_10429341g0010MA_225933g0010MA_1108864g0010MA_10433631g0010MA_10432229g0010
Populus trichocarpaPotri.007G081400.1Potri.006G031700.4Potri.016G028900.3Potri.016G028900.2Potri.016G028900.1
Potri.006G031700.3Potri.006G031700.2Potri.006G031700.1
Prunus persicappa003327mppa011408mppa000782m.305.951
Ricinus communis29719.m00033330045.m000475.200.845
Setaria italicaSi029329mSi034110m.272.920Si028900m.276.863Si028839m.276.923
Selaginella moellendorffii109836444105427302268243
Sorghum bicolorSb02g040000.1Sb02g042100.1.268.916
Thellungiella halophilaThhalv10003902mThhalv10016195m
Vitis viniferaGSVIVT01022223001GSVIVT01025810001.273.921
Volvox carteriVocar20008073mVocar20014639m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)