y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna31719.1-v1.0-hybrid
FamilyGT28
Protein PropertiesLength: 347 Molecular Weight: 38373.3 Isoelectric Point: 4.8744
ChromosomeChromosome/Scaffold: 1 Start: 14363085 End: 14366513
Descriptionmonogalactosyldiacylglycerol synthase 2
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT281553131.1e-31
  VLLMGGGEGMGPVKETARVLGESLFDKELGKPIGQLIVICGRNKNLVATLESDEWNIPVKIRGFETQMEKWMGSCDCIITKAGPGTIAEALIRGLPIILN
  DYIPGQEKGNVPCVVDNGAGVFTRSLKETARIVAEWFSTKPDELKRMSENALKLAQPEA
Full Sequence
Protein Sequence     Length: 347     Download
MLTFYFDDTF VIEQLDPDGK KFDKVSRIVA RSEKHGALLH LDVNTEIYPM GVKEKFLMVL    60
SPTLNYSGAP ITNEAQVEQK SLADKFEYIM YGLLYKMDHM RSESSDGGSK SPPLVEVYVS    120
FGGLQMRLRA DPNSCGKFKD QLREELEMDP ELPAVLLMGG GEGMGPVKET ARVLGESLFD    180
KELGKPIGQL IVICGRNKNL VATLESDEWN IPVKIRGFET QMEKWMGSCD CIITKAGPGT    240
IAEALIRGLP IILNDYIPGQ EKGNVPCVVD NGAGVFTRSL KETARIVAEW FSTKPDELKR    300
MSENALKLAQ PEAVFDIVKD IHDLACQRGP LANIPYILTS SFTSIN*                  360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK13609PRK136095.0e-22139321186+
PRK13608PRK136083.0e-22148324178+
pfam03870RNA_pol_Rpb83.0e-357139135+
smart00658RPOL8c5.0e-376133130+
PLN02605PLN026056.0e-129139328190+
Gene Ontology
GO TermDescription
GO:0005975carbohydrate metabolic process
GO:0006351transcription, DNA-dependent
GO:0016758transferase activity, transferring hexosyl groups
GO:0030246carbohydrate binding
GO:0030259lipid glycosylation
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2f3i_A9e-2461486145A Chain A, Solution Structure Of A Subunit Of Rna Polymerase Ii
PDB4bbs_H7e-1761416138A Chain A, Solution Structure Of A Subunit Of Rna Polymerase Ii
PDB4bbr_H7e-1761416138A Chain A, Solution Structure Of A Subunit Of Rna Polymerase Ii
PDB4a93_H7e-1761416138A Chain A, Solution Structure Of A Subunit Of Rna Polymerase Ii
PDB4a3m_H7e-1761416138A Chain A, Solution Structure Of A Subunit Of Rna Polymerase Ii
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_016_00340.4Aquca_016_00340.1Aquca_048_00001.3Aquca_048_00001.1Aquca_016_00340.2
Arabidopsis lyrata899522913288488950
Arabidopsis thalianaAT2G11810.1AT4G31780.2AT5G20410.1AT4G31780.1
Brachypodium distachyonBradi4g30600.1Bradi3g54387.1Bradi3g20020.1
Brassica rapaBra023984Bra011297Bra037199Bra020104
Carica papayaevm.model.supercontig_148.42evm.model.supercontig_277.14
Capsella rubellaCarubv10006327mCarubv10013637mCarubv10000862m
Chlamydomonas reinhardtiig14367.t1
Citrus clementinaCiclev10007936mCiclev10007956mCiclev10008213mCiclev10008083m
Citrus sinensisorange1.1g036427morange1.1g012492m
Cucumis sativusCucsa.162930.1Cucsa.132470.1
Eucalyptus grandisEucgr.C04035.1Eucgr.C00320.1Eucgr.C00495.1Eucgr.C04379.1Eucgr.C04035.2
Fragaria vescamrna14993.1-v1.0-hybridmrna30765.1-v1.0-hybrid
Glycine maxGlyma17g33780.1Glyma14g12120.1Glyma13g23150.1Glyma17g11720.1
Gossypium raimondiiGorai.010G119700.2Gorai.001G039100.1Gorai.010G119700.1Gorai.013G236200.1Gorai.009G014700.1
Gorai.009G014700.3
Linum usitatissimumLus10026895Lus10003418Lus10016359Lus10008048
Malus domesticaMDP0000135680MDP0000244574MDP0000214451MDP0000829982MDP0000305295
Manihot esculentacassava4.1_005396mcassava4.1_005397mcassava4.1_006812m
Medicago truncatulaMedtr4g115920.2Medtr4g115920.1
Mimulus guttatusmgv1a004593mmgv1a006191m
Oryza sativaLOC_Os09g25580.1LOC_Os02g55910.2LOC_Os02g55910.1LOC_Os08g20420.1LOC_Os08g20420.2
Panicum virgatumPavirv00042978mPavirv00044523mPavirv00010348mPavirv00051656mPavirv00029899m
Pavirv00008414mPavirv00051657m
Physcomitrella patensPp1s33_287V6.1Pp1s20_66V6.1
Phaseolus vulgarisPhvul.001G042600.1Phvul.003G171300.1
Picea abiesMA_5461g0010
Populus trichocarpaPotri.006G266500.1Potri.018G016600.1Potri.006G063300.3Potri.006G063300.2Potri.006G063300.1
Potri.018G123000.1Potri.006G266500.2
Prunus persicappa003927mppa006453m
Ricinus communis29848.m00450927394.m000347
Setaria italicaSi029462mSi016983mSi015030m
Selaginella moellendorffii271007
Sorghum bicolorSb02g025070.1Sb04g036240.1Sb07g027910.1
Thellungiella halophilaThhalv10024883mThhalv10022676mThhalv10013431m
Vitis viniferaGSVIVT01035995001GSVIVT01012838001
Volvox carteriVocar20009507m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)