y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna32062.1-v1.0-hybrid
FamilyGT1
Protein PropertiesLength: 949 Molecular Weight: 104534 Isoelectric Point: 5.3162
ChromosomeChromosome/Scaffold: 5 Start: 2590387 End: 2597749
DescriptionUDP-glucosyl transferase 72B3
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12384111e-32
  PVGPITTETGSTDWDANVRLKYWLNEQPNESVLFISFGSGGTISREQMNELALGLEKSGVRFLWNFRCPNETSKNAAYFDDHRSSIDPSSVLPQGFLQRT
  KDVGLVVTSWVPQVLILSHGSISGFLSHCGWNSTLESIVNGVPMIAWPLYAEQRMNAVLLDEDLKVAWRVKMND
Full Sequence
Protein Sequence     Length: 949     Download
MKRPHVAIVP SPGLGHLLPL VELAKRLVVH HHFRVTFFVP SDDGSNLITP YRRVLDPLPF    60
SISSIFLPPI NFNHLPKDIK HLTRIALTMT RSLPALRDSI KALAEPTRLV ALVVDLFGGE    120
ALDVAKEFNV LPYILYPTNA MVLWFHFELP KLDQTTSCEY WDLPKPITLP GCVPIEGKNL    180
LDSVQDRTNE AYKVLVDVSK RYKSAAGIMI NSFVDLQPGA FRAFREQGQG LGLPPIYPVG    240
PITTETGSTD WDANVRLKYW LNEQPNESVL FISFGSGGTI SREQMNELAL GLEKSGVRFL    300
WNFRCPNETS KNAAYFDDHR SSIDPSSVLP QGFLQRTKDV GLVVTSWVPQ VLILSHGSIS    360
GFLSHCGWNS TLESIVNGVP MIAWPLYAEQ RMNAVLLDED LKVAWRVKMN DKGIVESQDI    420
AKYAKGLIEG EEGDVLRKRI VELKDASQVA LSQDGSSSKS LAEVHHASGV VKVVWVPPQF    480
GHAVACVCAD GTLSLWEETV EDAQPVQWKL CKSFKSDSAQ MLDVEFGSSS SSLKMVTAYS    540
DGSVKIYELL DPLELKNWQL QAEIQNVIDS VSTLGKAVCL QASISWNPRG GESQETSFVL    600
GFNSDTQQLN SSKVWEFDQA HQRWLPVAEL ASPDEKGVQV YAVAWAPNIG RPYEVIAVAT    660
HKGISIWHLG LNPDSDGRLS TEKVAQLTGH KGEVWQLEWD MSGMTLASTG SDGDESKVGL    720
LKSLPNADTN LLLFSADIYN PNDFKPAIEG CEFVFHVATP MQHNSQSSQY KDTAEAAIAG    780
VRSIADSCIR SQTVKRLIYT ASIFSMSPRN NDGVGFRPLL DESCWTPLDA SSTYGNEFTL    840
GYIKSKTLAE KAVLSYNDFD DSKLEVVTLP CGLVGGESLL SYLPLSVRVI LAQLTGDILI    900
EGPEEGSKSD FSKLKKMGFE YKYGIKEILD DSVAWAKKLN GSPFSQVV*                960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02554PLN025541.0e-759461499+
PLN00164PLN001642.0e-801466488+
PLN03004PLN030042.0e-851458481+
PLN03015PLN030151.0e-931463473+
PLN02992PLN029924.0e-1033464481+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:00038543-beta-hydroxy-delta5-steroid dehydrogenase activity
GO:0005515protein binding
GO:0006694steroid biosynthetic process
GO:0008152metabolic process
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A024645463A Chain A, Cpgh89 (E483q, E601q), From Clostridium Perfringens, In Complex With Its Substrate Glcnac-Alpha-1,4-Galactose
PDB2vch_A024645463A Chain A, Cpgh89 (E483q, E601q), From Clostridium Perfringens, In Complex With Its Substrate Glcnac-Alpha-1,4-Galactose
PDB2vce_A024645463A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2acw_B024648457A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2acw_A024648457A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00152.1Aquca_013_00140.1Aquca_013_00137.1Aquca_012_00157.1Aquca_013_00138.1
Aquca_007_00151.1Aquca_035_00178.1Aquca_035_00180.1
Arabidopsis lyrata496932490463470140470138490956
485420319804479115480763
Arabidopsis thalianaAT4G01070.1AT1G01390.1AT1G01420.1AT4G36770.1AT5G66690.1
AT5G26310.1AT3G50740.1AT2G18570.1AT2G18560.1AT3G16520.3
AT3G16520.2AT3G16520.1
Brachypodium distachyonBradi4g14500.1Bradi1g70370.1Bradi2g49067.1Bradi4g36970.1Bradi2g43810.1
Bradi2g43790.1Bradi3g09180.1Bradi2g49120.1Bradi3g21020.1Bradi2g49057.2
Bradi2g47430.1Bradi2g19160.1Bradi2g19100.1Bradi2g49090.1Bradi2g19170.1
Bradi2g49100.1Bradi2g47420.2Bradi2g47420.1Bradi4g13760.1Bradi2g49110.1
Bradi2g49080.1Bradi2g49057.1Bradi2g19147.1Bradi2g19177.1Bradi3g09190.1
Bradi4g39220.1Bradi1g62500.1
Brassica rapaBra000942Bra037386Bra008540Bra008535Bra033266
Bra012893Bra011705Bra037155Bra012092Bra012892
Bra038862Bra024460Bra028098
Carica papayaevm.model.supercontig_64.59evm.model.supercontig_59.19evm.model.supercontig_59.17evm.model.supercontig_59.18evm.model.supercontig_158.10
evm.model.supercontig_158.11
Capsella rubellaCarubv10003907mCarubv10011054mCarubv10019444mCarubv10006214mCarubv10026316m
Carubv10013620mCarubv10015338mCarubv10016170m
Citrus clementinaCiclev10007122mCiclev10019927mCiclev10011599mCiclev10011601mCiclev10011598m
Ciclev10015042mCiclev10001016mCiclev10020010mCiclev10025462mCiclev10001013m
Ciclev10008085mCiclev10025490mCiclev10027249mCiclev10006910mCiclev10004867m
Ciclev10004863mCiclev10025535m
Citrus sinensisorange1.1g046392morange1.1g045267morange1.1g011381morange1.1g012513morange1.1g011396m
orange1.1g042249morange1.1g012063morange1.1g047445morange1.1g011099morange1.1g046326m
orange1.1g041419morange1.1g043859morange1.1g011608morange1.1g036436morange1.1g045281m
orange1.1g042987morange1.1g044031m
Cucumis sativusCucsa.259040.1Cucsa.259050.1Cucsa.104910.1Cucsa.201450.1
Eucalyptus grandisEucgr.H01249.1Eucgr.L01657.1Eucgr.D02351.1Eucgr.D02353.1Eucgr.D02357.1
Eucgr.D02354.1Eucgr.D02356.1Eucgr.L01659.1Eucgr.H01251.1Eucgr.H01250.1
Eucgr.L01660.1Eucgr.L03088.1Eucgr.H01252.1Eucgr.H01244.1Eucgr.H01241.1
Eucgr.I02471.1Eucgr.F01543.1Eucgr.H01240.1Eucgr.H01242.1Eucgr.I02470.1
Eucgr.H01243.1Eucgr.H01247.1Eucgr.A02703.1Eucgr.C01900.1Eucgr.A02689.1
Eucgr.C01905.1Eucgr.B03865.1Eucgr.C01901.1Eucgr.A02692.1Eucgr.C01902.1
Eucgr.A02709.1Eucgr.A02694.1Eucgr.B03860.1Eucgr.H01245.1Eucgr.A02695.1
Eucgr.A02701.1Eucgr.F02998.1Eucgr.A02693.1Eucgr.F02997.1Eucgr.B03862.1
Eucgr.A02708.1Eucgr.A02706.1Eucgr.A02700.1Eucgr.B03858.1Eucgr.D00095.1
Eucgr.D00097.1Eucgr.D00098.1Eucgr.A02710.1Eucgr.A02713.1Eucgr.C01903.1
Eucgr.L02614.1
Fragaria vescamrna29531.1-v1.0-hybridmrna29534.1-v1.0-hybridmrna29527.1-v1.0-hybridmrna18900.1-v1.0-hybridmrna18903.1-v1.0-hybrid
mrna32055.1-v1.0-hybridmrna32056.1-v1.0-hybridmrna32061.1-v1.0-hybridmrna15107.1-v1.0-hybridmrna13167.1-v1.0-hybrid
mrna13163.1-v1.0-hybridmrna29533.1-v1.0-hybridmrna29526.1-v1.0-hybridmrna28059.1-v1.0-hybridmrna26881.1-v1.0-hybrid
mrna30501.1-v1.0-hybridmrna13164.1-v1.0-hybrid
Glycine maxGlyma08g44720.1Glyma08g44700.1Glyma07g14510.1Glyma03g25020.1Glyma03g25030.1
Glyma16g29330.1Glyma09g23600.1Glyma19g27600.1Glyma09g23330.1Glyma08g48240.1
Glyma06g36520.1Glyma03g41730.1Glyma19g44350.1Glyma07g13560.1Glyma07g13130.2
Glyma07g14530.2Glyma08g44740.1Glyma08g44760.1Glyma08g44710.1Glyma08g44730.1
Glyma08g44690.1Glyma08g44750.1Glyma01g38430.1Glyma0023s00410.2Glyma0023s00410.1
Glyma08g44681.1Glyma03g22640.1Glyma03g25000.1Glyma05g31500.1Glyma11g06880.2
Glyma03g26890.1Glyma09g23750.1Glyma06g36530.1Glyma16g29430.1Glyma03g26980.1
Glyma03g26940.1Glyma16g29380.1Glyma09g23310.1Glyma16g29420.1Glyma16g29400.1
Glyma16g29340.1Glyma09g23720.1Glyma03g03850.1Glyma03g03830.1Glyma12g28270.1
Glyma06g47890.2Glyma16g29370.1Glyma03g03870.1Glyma03g03841.1Glyma03g03861.1
Gossypium raimondiiGorai.001G156000.1Gorai.007G107100.1Gorai.008G124100.1Gorai.004G043400.1Gorai.008G185800.1
Gorai.008G069400.1Gorai.008G069500.1Gorai.003G016800.1Gorai.005G042500.1Gorai.008G069600.1
Gorai.008G273300.1Gorai.008G273200.1Gorai.008G273200.2Gorai.007G340400.1Gorai.001G261800.1
Gorai.001G261700.1Gorai.003G084700.1
Linum usitatissimumLus10001905Lus10003897Lus10005950Lus10029452Lus10029453
Lus10005951Lus10041715Lus10039588Lus10024035Lus10003900
Lus10001906Lus10041713Lus10003944Lus10024037Lus10027542
Lus10039301Lus10039302
Malus domesticaMDP0000875654MDP0000146703MDP0000922723MDP0000316379MDP0000597607
MDP0000128368MDP0000226447MDP0000765050MDP0000315038MDP0000546018
MDP0000164106MDP0000818140MDP0000933711MDP0000129053MDP0000251883
MDP0000318032MDP0000600192MDP0000244946MDP0000128265MDP0000277370
MDP0000242436MDP0000170162MDP0000288715.349.593MDP0000288715.349.593MDP0000277371
MDP0000135820MDP0000248148MDP0000836043MDP0000461555MDP0000688415
MDP0000375160MDP0000219282MDP0000052862MDP0000216076MDP0000517816
Manihot esculentacassava4.1_007352mcassava4.1_006778mcassava4.1_008336mcassava4.1_028991mcassava4.1_034151m
cassava4.1_029183mcassava4.1_006967mcassava4.1_025933mcassava4.1_017099mcassava4.1_007484m
cassava4.1_007441m
Medicago truncatulaMedtr7g047030.1Medtr7g047060.1Medtr8g008970.1.254.442Medtr8g008970.1.254.442Medtr1g019510.1
Medtr8g009070.1.263.449Medtr8g009070.1.263.449Medtr8g009070.1.263.449Medtr1g019520.1Medtr7g046490.1
Medtr8g006270.1Medtr8g008970.1.596.767Medtr8g008970.1.596.767Medtr7g117170.1Medtr7g047110.1
Medtr8g009050.1.740.929Medtr8g009050.1.740.929Medtr5g019580.1Medtr8g009070.1.726.914Medtr8g009070.1.726.914
Medtr8g009070.1.726.914Medtr8g009050.1.255.443Medtr8g009050.1.255.443Medtr7g047230.1Medtr8g008990.1
Medtr6g087160.1AC233783_24.1Medtr8g006220.1Medtr6g023980.1Medtr6g005600.1
Medtr8g006260.1Medtr8g077590.1Medtr8g074550.1
Mimulus guttatusmgv1a005645mmgv1a019456mmgv1a005604mmgv1a020359mmgv1a027171m
mgv1a024118mmgv1a005797mmgv1a023866mmgv1a005593mmgv1a026814m
mgv1a024078mmgv1a006327mmgv1a020496mmgv1a006058m
Oryza sativaLOC_Os11g38650.1LOC_Os01g43280.1LOC_Os05g12450.1LOC_Os02g14540.1LOC_Os01g43270.1
LOC_Os02g14570.1LOC_Os02g14680.1LOC_Os01g50200.1LOC_Os02g14630.1LOC_Os01g53350.1
LOC_Os02g14590.1LOC_Os01g53370.1LOC_Os01g53350.2LOC_Os01g53330.1LOC_Os01g53390.1
LOC_Os05g45150.1LOC_Os05g45200.1LOC_Os01g53420.1LOC_Os01g53460.1LOC_Os01g53430.1
LOC_Os05g45090.1LOC_Os10g07970.1LOC_Os05g45100.1LOC_Os05g45110.1LOC_Os05g45080.1
LOC_Os06g23560.1LOC_Os03g62480.1LOC_Os05g45180.1LOC_Os09g30980.1LOC_Os01g64910.1
Panicum virgatumPavirv00026060mPavirv00005859mPavirv00003341mPavirv00026436mPavirv00043753m
Pavirv00035356mPavirv00051118mPavirv00056590mPavirv00047677mPavirv00004458m
Pavirv00052433mPavirv00012746mPavirv00058890mPavirv00032734mPavirv00039146m
Pavirv00029326mPavirv00010218mPavirv00033651mPavirv00063437mPavirv00058163m
Pavirv00062848mPavirv00058201mPavirv00018682mPavirv00000921mPavirv00013192m
Pavirv00004573mPavirv00031356mPavirv00040548mPavirv00038938mPavirv00044865m
Pavirv00070513mPavirv00067247mPavirv00053631mPavirv00039241mPavirv00030706m
Pavirv00062847mPavirv00033625mPavirv00049902mPavirv00001750mPavirv00017646m
Pavirv00022033mPavirv00051307mPavirv00003392mPavirv00013210mPavirv00035633m
Pavirv00067178mPavirv00062850mPavirv00050738mPavirv00052177mPavirv00058723m
Pavirv00017535mPavirv00062849mPavirv00053720mPavirv00016816mPavirv00006583m
Pavirv00032115mPavirv00070514m
Phaseolus vulgarisPhvul.008G140500.1Phvul.004G104100.1Phvul.008G140600.1Phvul.010G042200.1Phvul.008G140800.1
Phvul.006G111400.1Phvul.009G120600.1Phvul.010G042300.1Phvul.010G042500.1Phvul.010G042400.1
Phvul.004G041000.1Phvul.010G042600.1Phvul.008G140700.1Phvul.002G096500.1Phvul.010G053700.1
Phvul.002G026900.1Phvul.003G021900.1Phvul.005G005500.1Phvul.004G104200.1Phvul.005G005400.1
Phvul.005G005600.1Phvul.005G005600.2Phvul.004G103900.1Phvul.010G071900.1Phvul.010G053500.1
Picea abiesMA_10433602g0010MA_2005g0010MA_79075g0010MA_124563g0010MA_150838g0010
MA_80035g0010MA_334361g0010MA_133989g0010MA_100190g0010MA_108680g0010
MA_35841g0010MA_7897615g0010MA_448422g0010MA_10430887g0020MA_10427806g0010
MA_859383g0010MA_39071g0010MA_202558g0010
Populus trichocarpaPotri.004G069700.1Potri.002G168600.1Potri.014G096100.1Potri.014G096100.2Potri.014G096000.1
Potri.003G138200.1Potri.014G041800.1Potri.007G030400.1Potri.007G030300.1Potri.007G029800.1
Potri.007G030500.1Potri.017G150100.1Potri.015G027700.1Potri.012G035800.1Potri.015G027800.1
Potri.T010800.1Potri.017G150000.1Potri.004G070900.1Potri.004G071000.1Potri.004G070000.1
Potri.004G069600.1Potri.004G069800.1Potri.004G069900.1Potri.004G070800.1Potri.012G036000.1
Prunus persicappa008326mppa005039mppa024809mppa023599mppa020191m
ppa025290mppa015442mppa005112mppa005075mppa015127m
ppa017186mppa005342mppa025073mppa020773m
Ricinus communis28355.m00010230169.m00657630074.m00141829646.m001063
Setaria italicaSi028070mSi026309mSi028025mSi026310mSi004650m
Si001259mSi021923mSi001131mSi016987mSi004742m
Si004522mSi004762mSi033395mSi019234mSi019090m
Si025236mSi039984mSi021912mSi001309mSi025036m
Si001302mSi035416mSi001232mSi001348mSi001290m
Si021955mSi013668mSi001313mSi032267mSi001269m
Si015100mSi001251mSi005201mSi024487mSi039570m
Si007997mSi019420mSi004993mSi024035m
Sorghum bicolorSb10g023110.1Sb05g021870.1Sb05g023250.1Sb05g023240.1Sb04g008700.1.671.968
Sb04g008700.1.671.968Sb09g006910.1Sb03g028190.1Sb04g008700.1.28.463Sb04g008700.1.28.463
Sb02g022260.1Sb02g036220.1Sb03g033810.1Sb02g036210.1Sb09g026310.1
Sb04g003400.1Sb03g033840.1Sb03g032050.1Sb09g026260.1Sb03g034410.2
Sb03g034410.1Sb09g026240.1Sb09g026280.1Sb03g033890.1Sb08g019890.1
Sb03g033870.1Sb03g034130.1Sb01g035800.1Sb09g026250.1Sb07g011880.1
Sb03g033880.1Sb09g026270.1Sb03g033830.1Sb05g017280.1Sb03g033833.1
Sb03g028200.1
Thellungiella halophilaThhalv10010327mThhalv10028623mThhalv10010005mThhalv10010324mThhalv10005518m
Thhalv10025160mThhalv10020674mThhalv10018509mThhalv10022671m
Vitis viniferaGSVIVT01019508001GSVIVT01027064001GSVIVT01009658001GSVIVT01019017001GSVIVT01012581001
GSVIVT01018499001GSVIVT01028807001GSVIVT01026054001GSVIVT01026049001GSVIVT01012577001
GSVIVT01028961001
Zea maysAC206788.3_FGT015
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)