y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna32087.1-v1.0-hybrid
FamilyCBM49
Protein PropertiesLength: 725 Molecular Weight: 79413.1 Isoelectric Point: 8.8421
ChromosomeChromosome/Scaffold: 5 Start: 2725023 End: 2731420
Descriptionglycosyl hydrolase 9C2
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM496327092.69999e-40
  IAIAQKVTSSWVSKGVTYYRYSTTVTNKSGKTLNNLKLTISKLYGPLWGLTKTGDSYVFPSWLNSLPAGKSLEFVYIH
GH91315920
  DYGAALSKSILFFEAQRSGVLPHNQRVTWRSHSGLYDGKASGVNLVGGYYDAGDNVKFGLPMAFTVTMMSWSIIEYGKQMASSGELGHALDAVKWGTDYF
  IKAHPEPNVLYGEVGDGNTDHYCWQRPEDMTTDRRAYKISPSNPGSDLAGETAAAMAAASIVFRRTNPAYSRELLQHAYQLFDFADKYRGKYDSSITVAQ
  KYYRSISGYNDELLWAAAWLYQASNNEYYLNYLAVNGDSMGGTGWGMTEFGWDVKYSGVQTLVAKFLMQGKAGKHAAVFQKYTAKAEYFMCSCLGKGSRN
  AQKTPGGLLFRQRWNNMQFVTSASFLATVYSDYLTSSRRTLKCASGNVAPSELLSFAKSQVDYILGDNPRATSYMVGYGNNYPQQVHHRGSSIVSIKKDS
  SFVSCRGGYATWFSRKASDPNLLTGAIVGGPDAYDNFADQRDNYEQTEPATYNNAPLIGILA
Full Sequence
Protein Sequence     Length: 725     Download
MELSVVCRVV GYSNPGYRSN FLLSYLCVTL TRCKCVTTPP ASMSLPSVVF FYVYAPLLNP    60
GVLQFVFVFH GDEYGLTLFS LPVDLSEFLA DKPSDIASID QCFSMEKFVR LVSLAPLLLL    120
LCFPLALAGH DYGAALSKSI LFFEAQRSGV LPHNQRVTWR SHSGLYDGKA SGVNLVGGYY    180
DAGDNVKFGL PMAFTVTMMS WSIIEYGKQM ASSGELGHAL DAVKWGTDYF IKAHPEPNVL    240
YGEVGDGNTD HYCWQRPEDM TTDRRAYKIS PSNPGSDLAG ETAAAMAAAS IVFRRTNPAY    300
SRELLQHAYQ LFDFADKYRG KYDSSITVAQ KYYRSISGYN DELLWAAAWL YQASNNEYYL    360
NYLAVNGDSM GGTGWGMTEF GWDVKYSGVQ TLVAKFLMQG KAGKHAAVFQ KYTAKAEYFM    420
CSCLGKGSRN AQKTPGGLLF RQRWNNMQFV TSASFLATVY SDYLTSSRRT LKCASGNVAP    480
SELLSFAKSQ VDYILGDNPR ATSYMVGYGN NYPQQVHHRG SSIVSIKKDS SFVSCRGGYA    540
TWFSRKASDP NLLTGAIVGG PDAYDNFADQ RDNYEQTEPA TYNNAPLIGI LARLGGGQSS    600
YNQLLPVVTS QPKQTPVPKL TPAAPASTSG PIAIAQKVTS SWVSKGVTYY RYSTTVTNKS    660
GKTLNNLKLT ISKLYGPLWG LTKTGDSYVF PSWLNSLPAG KSLEFVYIHA ASAANVLVSS    720
YSLA*                                                                780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02171PLN021710129724602+
PLN02340PLN023400129721596+
PLN02420PLN024200129610486+
pfam00759Glyco_hydro_90131592464+
PLN00119PLN001190131594464+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005576extracellular region
GO:0005975carbohydrate metabolic process
GO:0030246carbohydrate binding
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A01305943428A Chain A, Crystal Structure Of The C-Terminal Globular Domain Of Oligosaccharyltransferase (Af_0329) From Archaeoglobus Fulgidus
PDB1ksc_A01305943428A Chain A, Crystal Structure Of The C-Terminal Globular Domain Of Oligosaccharyltransferase (Af_0329) From Archaeoglobus Fulgidus
PDB1ks8_A01305943428A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB2xfg_A012459418459B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
PDB4tf4_B01315945440B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
Transmembrane Domains
StartEnd
4769
111133
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01464.1.518.596Aquca_037_00141.1.542.619Aquca_013_00114.1.534.611
Arabidopsis lyrata474038.535.614489943.534.611892975.528.605
Arabidopsis thalianaAT1G64390.1.528.605AT1G48930.1.535.614AT4G11050.1.534.611
Brachypodium distachyonBradi2g32270.1.538.616Bradi2g07150.1.534.613
Brassica rapaBra032270.517.596Bra000732.268.345Bra027699.529.606Bra018765.532.611Bra027735.528.605
Carica papayaevm.model.supercontig_183.4.367.446evm.TU.contig_27379.2.529.606
Capsella rubellaCarubv10012624m.534.613Carubv10003874m.535.612Carubv10019981m.528.605
Citrus clementinaCiclev10019301m.537.614Ciclev10033912m.569.648
Citrus sinensisorange1.1g043219m.499.578orange1.1g019436m.249.326orange1.1g017562m.277.354orange1.1g011712m.387.464orange1.1g006835m.537.614
Cucumis sativusCucsa.107370.1.527.604Cucsa.128330.1.503.582Cucsa.303850.1.533.608
Eucalyptus grandisEucgr.D01733.1.529.606Eucgr.J00862.1.484.562Eucgr.E00858.1.526.602Eucgr.D01896.1
Fragaria vescamrna32087.1-v1.0-hybrid.632.709mrna11058.1-v1.0-hybrid.533.612
Glycine maxGlyma12g03050.1.537.616Glyma05g36930.1.532.609Glyma08g02610.1.533.610Glyma11g10760.1.535.614
Gossypium raimondiiGorai.003G080800.1.533.609Gorai.008G254000.1.534.611Gorai.004G133700.1.536.613Gorai.005G210200.1.530.608
Linum usitatissimumLus10003888.529.606Lus10010201.535.613Lus10032377.534.611Lus10017402.508.586Lus10001833.527.603
Lus10033956
Malus domesticaMDP0000276676.536.613MDP0000131267.528.605MDP0000548943MDP0000722052.313.390MDP0000826600.538.616
Manihot esculentacassava4.1_004404m.486.565cassava4.1_003698m.530.607
Medicago truncatulaMedtr4g074960.1.571.649
Mimulus guttatusmgv1a003302m.501.580
Oryza sativaLOC_Os01g12070.1.544.625LOC_Os01g12030.1.543.620LOC_Os04g57860.1.531.610LOC_Os05g12150.1.535.613
Panicum virgatumPavirv00000152m.548.625Pavirv00066185m.348.426Pavirv00000772m.535.612Pavirv00030375m.537.614Pavirv00029375m.528.607
Physcomitrella patensPp1s176_127V6.1.544.623
Phaseolus vulgarisPhvul.011G030300.1.567.645Phvul.002G297600.1.530.607
Picea abiesMA_895058g0010MA_10437098g0010.516.596MA_127108g0010.524.603MA_42717g0010.527.604MA_10241783g0010.543.621
MA_19509g0020.547.626
Populus trichocarpaPotri.003G139600.1.530.607Potri.001G092200.1.530.607Potri.001G092200.5.285.362Potri.007G071200.1.520.599Potri.007G071200.2.519.598
Potri.001G092200.4.375.452
Prunus persicappa002939m.528.605ppa022524m.499.578
Ricinus communis29675.m000388.528.607
Setaria italicaSi000642m.549.626Si021474m.530.607Si021476m.528.606
Selaginella moellendorffii234652.525.60399802.550.630
Sorghum bicolorSb09g006670.1.535.612Sb03g001560.1.561.639Sb06g032760.1.534.615
Thellungiella halophilaThhalv10023353m.527.604Thhalv10011318m.534.613Thhalv10028514m.535.612
Vitis viniferaGSVIVT01019523001.537.614GSVIVT01012043001.524.602
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)