y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna32454.1-v1.0-hybrid
FamilyGT47
Protein PropertiesLength: 1872 Molecular Weight: 212860 Isoelectric Point: 8.8014
ChromosomeChromosome/Scaffold: 5 Start: 1425412 End: 1433009
DescriptionC2 calcium/lipid-binding plant phosphoribosyltransferase family protein
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT47122215550
  CEGRGVYVYDLPSKFNKDLLGQCRDMVPWMDFCEYFKNEALGESIPKLGDGWYHTHQYSLEPIFHQRILNHPCRVHSENEAKLFYVPFYGGLDILRWHFK
  NVSNDVKDTLSLELITWLKKQDFWRKNSGRDHVLVLGKISWDFRRKDGSWGTNFLEIDQMQNPIKLLIERQPWQQNDVGIPHPTFFHPNSDDDIMALQWK
  IISSYRKTLVSFAGAARPSAAESIRSTLIDQCNSAENGKCHFLNCHTGDCDKPESVIELFMESEFCLQPPGDSPTRKSLFDSLISGCIPVLFDPFTAYYQ
  YPWHLPVEHGKYSVFIDQKDVRGMKVNVVEMLMK
Full Sequence
Protein Sequence     Length: 1872     Download
MNNLKLGVDV VSAHNLLPKD GQGSSDAFVE LYFDGQRFRS TIKEKDLNPV WNESFYFNIA    60
DPSNLHYLTL EAYVYNNVKA THSRSFLGKI SVTGNSFVPY SDAVVLHYPL EKRGIFSRVR    120
GELGLKVYVT DDPTIKSSTP MPASESLTDQ DPGLAQTQGV SAPGMSSFRS EKSQARHTFH    180
HLPNPGQESQ HQHHASAAPD THYVPKHEAD QMKSEQQPAK LVRMYSASAS QPVDYALKET    240
SPYLGGGRVV GGRVIHGDKT ASTYDLVERM YFLYVRVVKA RELPAMDVTG SLDPFVEARI    300
GNYRGITKHY EKQQNPVWNQ VFAFSKDRMQ ASVLEVVVKD KDLLKDDFVG IVRFDINEVP    360
LRVPPDSPLA PEWYRLADKK GEKIKGELML AVWIGTQADE AFSDAWHSDA ATPVDSSPAA    420
SAVIRSKVYH APRLWYVRVN VIEAQDLFAT EKNRFPDAYV KVQIGNQVMK TKTLQARNLN    480
PLWNEDLLFV ASEPFEDHLV ISVEDRVGPG KDEILGRVIL PLNSVDRRAD DRMIHSRWFN    540
LEKPVAVDVD QLKKEKFSSR IHLRVCLDGG YHVLDESTHY SSDLRPTAKQ LWRPAIGVLE    600
LGILNAVGLH PMKTRDGRGT SDTYCVAKYG HKWVRTRTLV DNLCPKYNEQ YTWEVFDPST    660
VLTVGVFDNS QLGDKDSNGH KDLKIGKVRI RISTLEAGRI YTHSYPLLVL HPAGVKKMGE    720
LHLAIRFSCT SFVNMLYTYS KPLLPKMHYV RPFNVMQLDM LRHQAVNIVA ARLGRAEPPL    780
RKEVVEYMSD VDSHLWSMRR SKANFFRLMT VFSGVFAIGK WFTDICMWKN PITTVLVHVL    840
FLMLVFFPEL ILPTAFLYMF LIGVWNFRYR PRYPPHMNTK ISQADLVHPD ELDEEFDTFP    900
TSRNPELVRM RYDRLRSVAG RIQTVVGDVA TQGERLQALL SWRDPRATAL FVTFCLIAAL    960
VMYVTPFQVV AALAGFFMMR HPRFRHRMPS APINFFRRLP ARTDNHCWPE RNCPNKKQER    1020
NVETASFLPK MAVALSKRSS KHLKKEAPKR EPCFCLSPCL CFIALFKFLY RLPAAFLLLF    1080
LIYLWSSSTT IISGNIVHVC ISSRKLNNHY CLSAGSTRPK FELPNLNNAT HYLHTPDPSS    1140
NLSISISPPL SQNNSPISPP PPKVSSEIVI RETVQVVHDE SDPVKNGANK EREEEIANAK    1200
KQVEEQLRLH RSWISNKKHE GCEGRGVYVY DLPSKFNKDL LGQCRDMVPW MDFCEYFKNE    1260
ALGESIPKLG DGWYHTHQYS LEPIFHQRIL NHPCRVHSEN EAKLFYVPFY GGLDILRWHF    1320
KNVSNDVKDT LSLELITWLK KQDFWRKNSG RDHVLVLGKI SWDFRRKDGS WGTNFLEIDQ    1380
MQNPIKLLIE RQPWQQNDVG IPHPTFFHPN SDDDIMALQW KIISSYRKTL VSFAGAARPS    1440
AAESIRSTLI DQCNSAENGK CHFLNCHTGD CDKPESVIEL FMESEFCLQP PGDSPTRKSL    1500
FDSLISGCIP VLFDPFTAYY QYPWHLPVEH GKYSVFIDQK DVRGMKVNVV EMLMKIPKEN    1560
RDDMRRHIVY ELLPGLVYGD SNAQFDKFQD AFSITMSNLM ERVTKLELAT DNSVLAPPRV    1620
TYYTTYVEAP SSSTSTSQNL ASQMLCSSSR LVFRRNLAVA AALVFPRQFS TVSKNTLLRP    1680
SCFPSIKAQS FNPVSSFQFN RSMASQSSQP KTVHDFTVKD ARGNDVDLST YKGKVLLIVN    1740
VASQCGLTNS NYTELAQLYE KYKTQGLEIL AFPCNQFGAQ EPGSNDEIVE FACTRFKAEY    1800
PIFDKVDVNG DKATPLYKFL KSSKGGLFGD SIKWNFSKFL VDKEGNVVNR YAPTTTPLSI    1860
EKDVKKLLGV A*                                                        1920
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd04019C2C_MCTP_PRT_plant1.0e-81436586151+
cd00340GSH_Peroxidase1.0e-8217121864153+
PLN02412PLN024122.0e-8717031871169+
PLN02399PLN023991.0e-8716601868209+
pfam08372PRT_C2.0e-908521004153+
Gene Ontology
GO TermDescription
GO:0004602glutathione peroxidase activity
GO:0005515protein binding
GO:0006979response to oxidative stress
GO:0016020membrane
GO:0016209antioxidant activity
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2p5r_B0170318711170A Chain A, Respiratory Complex Ii-Like Fumarate Reductase From Wolinella Succinogenes
PDB2p5r_A0170318711170A Chain A, Respiratory Complex Ii-Like Fumarate Reductase From Wolinella Succinogenes
PDB2p5q_D0170318711170A Chain A, Crystal Structure Of The Poplar Glutathione Peroxidase 5 In The Reduced Form
PDB2p5q_C0170318711170A Chain A, Crystal Structure Of The Poplar Glutathione Peroxidase 5 In The Reduced Form
PDB2p5q_B0170318711170A Chain A, Crystal Structure Of The Poplar Glutathione Peroxidase 5 In The Reduced Form
Transmembrane Domains
StartEnd
805822
835857
956978
10751097
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_013_00701.1Aquca_025_00047.1Aquca_038_00043.1Aquca_003_00092.1Aquca_013_00533.1
Aquca_030_00256.1
Arabidopsis lyrata480865901861359365902333493853
915506344960482210492611919476
339091893098920989
Arabidopsis thalianaAT2G29040.1AT2G20370.1AT5G41250.1AT1G63450.1AT2G32750.1
AT4G13990.1AT4G22580.1AT2G31990.1AT2G32740.1AT5G62220.1
AT1G68470.1
Brachypodium distachyonBradi1g75450.1Bradi3g28020.1Bradi3g28027.1Bradi1g13110.1Bradi3g28012.1
Bradi3g28006.1Bradi3g32980.1Bradi3g28040.1Bradi1g78280.1Bradi5g18940.1
Bradi5g18927.1Bradi3g47480.1Bradi4g40070.1
Brassica rapaBra036680Bra036467Bra022900Bra028388Bra035655
Bra028492Bra022874Bra027802Bra005627Bra038960
Bra005559Bra021811Bra010065Bra004310Bra021763
Bra013627
Carica papayaevm.model.supercontig_29.130evm.model.supercontig_8.309evm.model.supercontig_81.132evm.model.supercontig_157.42evm.model.supercontig_3.255
evm.model.supercontig_157.43evm.model.supercontig_74.20
Capsella rubellaCarubv10025159mCarubv10013229mCarubv10023021mCarubv10006479mCarubv10025252m
Carubv10021808mCarubv10007051mCarubv10025326mCarubv10004820mCarubv10028275m
Carubv10020285m
Citrus clementinaCiclev10020110mCiclev10004973mCiclev10006440mCiclev10004838mCiclev10004905m
Ciclev10004921mCiclev10006490m
Citrus sinensisorange1.1g007197morange1.1g012984morange1.1g045731morange1.1g046652morange1.1g011220m
orange1.1g012090morange1.1g016487morange1.1g047350m
Cucumis sativusCucsa.140650.1Cucsa.320620.1Cucsa.135930.1Cucsa.095020.1Cucsa.125430.1
Cucsa.251330.1Cucsa.104410.1Cucsa.115600.1
Eucalyptus grandisEucgr.E00459.1Eucgr.A01318.1Eucgr.B02354.1Eucgr.H00492.1Eucgr.H02673.1
Eucgr.D01858.1Eucgr.A02868.1Eucgr.H02667.1Eucgr.D00738.1Eucgr.H00343.1
Fragaria vescamrna08349.1-v1.0-hybridmrna06574.1-v1.0-hybridmrna29211.1-v1.0-hybridmrna32241.1-v1.0-hybridmrna02225.1-v1.0-hybrid
mrna06576.1-v1.0-hybridmrna13394.1-v1.0-hybridmrna06572.1-v1.0-hybridmrna16329.1-v1.0-hybridmrna16326.1-v1.0-hybrid
mrna06573.1-v1.0-hybridmrna16325.1-v1.0-hybrid
Glycine maxGlyma13g18940.3Glyma13g18940.2Glyma10g04640.1Glyma19g35210.3Glyma19g35210.2
Glyma03g32481.1Glyma17g02880.1Glyma18g00560.1Glyma11g36640.1Glyma18g52010.1
Glyma18g52000.2Glyma11g02640.1Glyma08g29110.2Glyma20g29030.2Glyma20g00760.1
Glyma07g37751.1
Gossypium raimondiiGorai.007G150100.1Gorai.003G169500.1Gorai.006G224200.1Gorai.004G211300.1Gorai.011G152000.1
Gorai.001G111200.1Gorai.011G152600.1Gorai.006G226500.1Gorai.008G283000.3Gorai.008G283000.2
Gorai.008G283000.1Gorai.007G009300.1Gorai.009G098600.1Gorai.005G266400.1Gorai.009G374500.1
Gorai.001G182200.1
Linum usitatissimumLus10022862Lus10024961Lus10007037Lus10000604Lus10028924
Lus10006694Lus10016532Lus10004341Lus10001578Lus10004967
Lus10007426Lus10010677Lus10001028Lus10027386Lus10031685
Lus10015022Lus10013701Lus10005566Lus10013700Lus10005567
Lus10003440
Malus domesticaMDP0000697213MDP0000669665MDP0000204575MDP0000224103MDP0000315108
MDP0000317620MDP0000775334MDP0000899392MDP0000186840MDP0000661731
MDP0000317931MDP0000317621MDP0000839295MDP0000306185MDP0000301100
MDP0000828513MDP0000951395MDP0000131360MDP0000130660MDP0000133266
MDP0000290571MDP0000322393MDP0000132843MDP0000630192
Manihot esculentacassava4.1_004268mcassava4.1_004031mcassava4.1_032775mcassava4.1_007677mcassava4.1_026371m
cassava4.1_007928mcassava4.1_022618mcassava4.1_025515mcassava4.1_021548mcassava4.1_033519m
cassava4.1_005862mcassava4.1_023212mcassava4.1_029120m
Medicago truncatulaMedtr7g098650.1Medtr4g119810.1Medtr3g084400.1Medtr5g055350.1Medtr5g010370.1
Medtr5g010350.1Medtr5g095940.1Medtr1g102430.1Medtr3g007840.1Medtr5g095950.1
Mimulus guttatusmgv1a025815mmgv1a025992mmgv1a006271mmgv1a023797mmgv1a021582m
mgv1a007352mmgv1a004562m
Oryza sativaLOC_Os03g05110.1LOC_Os10g32170.1LOC_Os03g05060.2LOC_Os03g05060.1LOC_Os03g05070.1
LOC_Os12g38450.1LOC_Os10g32160.1LOC_Os10g32080.1LOC_Os10g40559.1LOC_Os06g23420.2
LOC_Os06g23420.1LOC_Os04g48480.1LOC_Os10g32110.1LOC_Os12g12290.1
Panicum virgatumPavirv00052911mPavirv00016514mPavirv00047043mPavirv00048669mPavirv00034812m
Pavirv00004154mPavirv00053716mPavirv00013474mPavirv00004155mPavirv00005480m
Pavirv00064113mPavirv00040881mPavirv00057287mPavirv00002639mPavirv00049145m
Pavirv00052250mPavirv00050116mPavirv00058137mPavirv00027041mPavirv00013287m
Pavirv00004398mPavirv00043727mPavirv00065473mPavirv00037613mPavirv00043360m
Pavirv00010825mPavirv00004150mPavirv00045520mPavirv00002799m
Physcomitrella patensPp1s5_379V6.1Pp1s158_189V6.1Pp1s47_268V6.1Pp1s60_282V6.1Pp1s5_370V6.1
Pp1s88_148V6.1Pp1s530_2V6.1Pp1s530_5V6.1Pp1s81_221V6.1Pp1s36_237V6.1
Pp1s21_30V6.1Pp1s1_428V6.1Pp1s26_8V6.1Pp1s236_30V6.1Pp1s20_115V6.1
Pp1s512_4V6.1Pp1s3_407V6.2Pp1s3_407V6.1Pp1s1_374V6.1
Phaseolus vulgarisPhvul.007G153600.1Phvul.001G266100.1Phvul.003G104800.2Phvul.003G104800.1Phvul.007G063500.1
Phvul.008G017900.1Phvul.002G157100.1Phvul.003G006800.1Phvul.001G165300.1
Picea abiesMA_10434404g0030MA_9990400g0010MA_371148g0010MA_372623g0010MA_100374g0010
MA_290104g0010MA_73539g0010MA_13968g0020MA_96103g0010MA_5948g0010
MA_76602g0010.250.389MA_76602g0010.250.389MA_10435411g0010MA_28102g0010.178.308MA_28102g0010.178.308
MA_7543346g0010
Populus trichocarpaPotri.002G256200.2Potri.002G256200.1Potri.001G120800.1Potri.014G147800.1Potri.009G032500.1
Potri.001G105300.1Potri.001G321000.1Potri.012G130700.1Potri.015G132600.1Potri.001G382200.1
Potri.001G381900.1Potri.003G112200.1Potri.003G126000.1
Prunus persicappa002811mppa005908mppa024321mppa016857mppa018367m
ppa018375mppa004844mppa006308mppa007371mppa007598m
ppa003851mppa004838mppa017713mppa008689mppa017934m
ppa025271m
Ricinus communis30190.m01120329002.m00014928455.m00036930065.m00113829637.m000730
30065.m00114130147.m01416130065.m00113628223.m000097
Setaria italicaSi034744mSi038964mSi035153mSi039422mSi038531m
Si039200mSi025042mSi039123mSi039377mSi019878m
Si012021mSi035637mSi036091mSi024608mSi008588m
Si004223m
Selaginella moellendorffii1012371181338576912679964314
126225123197983663817126870
Sorghum bicolorSb01g020070.1Sb01g047270.1Sb01g020080.1Sb01g047290.1Sb01g020060.1
Sb01g047300.1Sb08g018880.1Sb01g047280.1Sb01g047310.1Sb06g026020.1
Sb06g026010.1Sb01g047315.1Sb01g050380.1Sb01g029520.1Sb08g007160.1
Thellungiella halophilaThhalv10001932mThhalv10016337mThhalv10017561mThhalv10017898mThhalv10024922m
Thhalv10016613mThhalv10025220mThhalv10028137mThhalv10005582mThhalv10027680m
Thhalv10018517mThhalv10023358m
Vitis viniferaGSVIVT01019767001GSVIVT01031644001GSVIVT01028435001GSVIVT01004778001GSVIVT01001277001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)