y PlantCAZyme

CAZyme Information

Basic Information
SpeciesFragaria vesca
Cazyme IDmrna32579.1-v1.0-hybrid
FamilyCE10
Protein PropertiesLength: 794 Molecular Weight: 86919.5 Isoelectric Point: 5.417
ChromosomeChromosome/Scaffold: 4 Start: 2205427 End: 2211569
Descriptionacylaminoacyl-peptidase-related
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE105387761.1e-26
  FDPLIVFIHGGPHTVSSSSFSKSLAFLSAIGFNLLLVNYRGSLGFGEEALQSLPGNIGSQDVNDILVAIDHVIDVGLASPSKMAVLGGSHGGFLTTHLIG
  QAPEKFFAAATRNPACNLALMAPEKFFAAATRNPACNLALMVGTTDIPDWCYVEAYGTEGKNRYTEAPSAEHLALFHCKSPISHISKAKTPILFLLGAQD
  IRLPICSGLQYAQGLKEKGVTVKVIVFPNDNHPIDRPQS
Full Sequence
Protein Sequence     Length: 794     Download
MDGSRAVPLK EMPLGIDEIS EDEYASQSRL LQEFTSISSI DKAWIKSDSR NGSQAMFSIS    60
QPNLVANKRR KFILSSNISR EISNSVNFQW APFPVEMTGV SVIVPSPSGA KLLVVRNPEY    120
EAPCQFEIWG PAQVEKEFHI PQSVHGSVYA DEWFQGISWN SDETLIAYVA EEPSPSKPTF    180
TCQGYKKGST TDENFANWKG QGEWEEEWGE TYVGKGQPAL FVININSGET QAVRGIEKHL    240
SVGQVVWAPA VRGSHQFLVF VGWSANTRKL GIKYCYNRPC ALYAVKAPLC VSEDGQNIIS    300
RDNSVEDFPV VNLTQSTSSA YHPRFSPDGK LLLFLSSRSA VESGAHSATD SLLRMDWPID    360
GVLCSSAKIF DVIPVVMSAD DGCFPGLYCS SFLSNPWFSD GCTVVISSFW GSCQVVLSVN    420
VLSGEVLRIS PTNSNFSWNA LSLDEDNIIA VSSSLVDVPR IKYGYLVDRE RKSTAWNWLD    480
VPSPTNECSE KVESLLSSLQ FSIMKIPVRD VSDSLTKGAR NPFEAIFVSS KTNRSDSFDP    540
LIVFIHGGPH TVSSSSFSKS LAFLSAIGFN LLLVNYRGSL GFGEEALQSL PGNIGSQDVN    600
DILVAIDHVI DVGLASPSKM AVLGGSHGGF LTTHLIGQAP EKFFAAATRN PACNLALMAP    660
EKFFAAATRN PACNLALMVG TTDIPDWCYV EAYGTEGKNR YTEAPSAEHL ALFHCKSPIS    720
HISKAKTPIL FLLGAQDIRL PICSGLQYAQ GLKEKGVTVK VIVFPNDNHP IDRPQSDFES    780
FLNIGVWFKR YLF*                                                      840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0596MhpC0.0004539775264+
pfam12697Abhydrolase_62.0e-5542775238+
COG1505COG15058.0e-657365180+
pfam00326Peptidase_S97.0e-25568792228+
COG1506DAP28.0e-39309792489+
Gene Ontology
GO TermDescription
GO:0006508proteolysis
GO:0008152metabolic process
GO:0008236serine-type peptidase activity
GO:0016787hydrolase activity
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2qzp_B0.000000000000002531772332539A Chain A, Crystal Structure Of Mutation Of An Acylptide HydrolaseESTERASE FROM AEROPYRUM PERNIX K1
PDB2qzp_A0.000000000000002531772332539A Chain A, Crystal Structure Of Mutation Of An Acylptide HydrolaseESTERASE FROM AEROPYRUM PERNIX K1
PDB3o4g_D0.000000000000002531772352559A Chain A, Crystal Structure Of Mutation Of An Acylptide HydrolaseESTERASE FROM AEROPYRUM PERNIX K1
PDB3o4g_C0.000000000000002531772352559A Chain A, Crystal Structure Of Mutation Of An Acylptide HydrolaseESTERASE FROM AEROPYRUM PERNIX K1
PDB3o4g_B0.000000000000002531772352559A Chain A, Crystal Structure Of Mutation Of An Acylptide HydrolaseESTERASE FROM AEROPYRUM PERNIX K1
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00583.4Aquca_017_00583.3Aquca_017_00583.2Aquca_017_00583.1Aquca_015_00163.1
Arabidopsis lyrata915409859721
Arabidopsis thalianaAT4G14570.1AT5G36210.1
Brachypodium distachyonBradi3g26780.4Bradi3g26780.3Bradi3g26780.2Bradi3g26787.1Bradi1g45890.1
Brassica rapaBra039731Bra036867Bra037063Bra030822
Capsella rubellaCarubv10006608mCarubv10013057mCarubv10012695mCarubv10013077mCarubv10004231m
Chlamydomonas reinhardtiiCre05.g241650.t1.3Cre10.g423300.t1.1
Citrus clementinaCiclev10004377mCiclev10004325mCiclev10003676m
Citrus sinensisorange1.1g005093morange1.1g004149morange1.1g004141morange1.1g003363morange1.1g004816m
orange1.1g004757morange1.1g004756morange1.1g004735m
Cucumis sativusCucsa.386660.1Cucsa.123480.1Cucsa.123460.1
Eucalyptus grandisEucgr.H00222.1Eucgr.H00221.1Eucgr.F00026.5Eucgr.F00026.4Eucgr.F00026.3
Eucgr.F00026.2Eucgr.F00026.1Eucgr.F00028.1Eucgr.F00027.2Eucgr.F00027.1
Eucgr.L02208.1Eucgr.F00027.3Eucgr.F00025.1
Fragaria vescamrna29072.1-v1.0-hybridmrna09045.1-v1.0-hybridmrna09044.1-v1.0-hybrid
Glycine maxGlyma10g00350.1Glyma10g00320.1Glyma08g42730.1Glyma18g11480.3Glyma18g11480.2
Glyma18g11480.4
Gossypium raimondiiGorai.006G245500.5Gorai.006G245500.4Gorai.006G245500.3Gorai.006G245500.1Gorai.010G016900.1
Linum usitatissimumLus10039405Lus10015363Lus10032765Lus10021758
Malus domesticaMDP0000211874MDP0000304250MDP0000251803
Manihot esculentacassava4.1_002075mcassava4.1_031105mcassava4.1_005468m
Medicago truncatulaAC233668_48.1Medtr5g042400.2Medtr5g042400.1Medtr5g042410.1Medtr3g051310.1
Mimulus guttatusmgv1a001402mmgv1a001397mmgv1a002403m
Oryza sativaLOC_Os10g28020.3LOC_Os10g28020.1LOC_Os10g28020.2LOC_Os10g28030.2LOC_Os10g28030.1
LOC_Os06g11180.1
Panicum virgatumPavirv00008779mPavirv00061808mPavirv00015591mPavirv00045661mPavirv00003810m
Pavirv00003809m
Physcomitrella patensPp1s619_3V6.1Pp1s97_68V6.1Pp1s108_134V6.1Pp1s9_317V6.2Pp1s9_317V6.1
Pp1s139_36V6.2Pp1s139_36V6.1
Phaseolus vulgarisPhvul.007G279900.1Phvul.007G280000.1Phvul.006G042600.1Phvul.006G042700.1
Populus trichocarpaPotri.008G160400.1Potri.002G128700.9Potri.002G128700.8Potri.002G128700.7Potri.002G128700.6
Potri.002G128700.5Potri.002G128700.4Potri.002G128700.3Potri.002G128700.2Potri.002G128700.10
Potri.002G128700.1
Prunus persicappa001729mppa002365m
Ricinus communis29844.m00318230170.m01392428323.m000042
Setaria italicaSi034264mSi034356mSi006001mSi005937mSi005954m
Selaginella moellendorffii16830378836
Sorghum bicolorSb01g021970.4Sb01g021970.2Sb01g021970.1Sb01g021970.5Sb01g021960.1
Sb01g021970.3Sb10g007280.1Sb10g007270.1
Thellungiella halophilaThhalv10024477mThhalv10003712m
Vitis viniferaGSVIVT01018091001GSVIVT01009564001GSVIVT01009565001
Volvox carteriVocar20006950m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)