y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCitrus sinensis
Cazyme IDorange1.1g012912m
FamilyGT13
Protein PropertiesLength: 454 Molecular Weight: 52880.5 Isoelectric Point: 7.6258
ChromosomeChromosome/Scaffold: 00023 Start: 1285158 End: 1290106
Descriptionalpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase, putative
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT13314450
  IQMRLFATQSEYADRVAAAVEAENHCTNQMRLLIDQISMQQGRIVALEDEKKRRDEECGQLKALVKDLERRGLERLVDKVQVPVAAVVIMACNRANYLER
  TINSVFKYQGSVASKYPLFVSQDGSNPQVKSKALSYDKLTYMQHLDFEPVHADNPGELTAYYKIARHYKWALDNLFYKHNFSRVIILEDDMEIAPDFFDY
  FEAAADLLDKDKSIMAVSSWNDNGQKQFVHDPYVLYRSDFFPGLGWMLTRTTWDELSPKWPKAYWDDWLRLKENHKGRQFIRPEVCRTYNFGEHGSSLGQ
  FFQQYLAPIKLNDVPVDWKSRDLSYLIKDNYEKYFAEIVKKATPVHGENVVLKAHDIEGDVRIEYKDQSHFEIIARQFGIFNEWKDGIPRTAYKGVVVFR
  YQTPRRIFLVGPDSL
Full Sequence
Protein Sequence     Length: 454     Download
MLPENRNRKM AIPICDIRWL LLAAAVAFIF IQMRLFATQS EYADRVAAAV EAENHCTNQM    60
RLLIDQISMQ QGRIVALEDE KKRRDEECGQ LKALVKDLER RGLERLVDKV QVPVAAVVIM    120
ACNRANYLER TINSVFKYQG SVASKYPLFV SQDGSNPQVK SKALSYDKLT YMQHLDFEPV    180
HADNPGELTA YYKIARHYKW ALDNLFYKHN FSRVIILEDD MEIAPDFFDY FEAAADLLDK    240
DKSIMAVSSW NDNGQKQFVH DPYVLYRSDF FPGLGWMLTR TTWDELSPKW PKAYWDDWLR    300
LKENHKGRQF IRPEVCRTYN FGEHGSSLGQ FFQQYLAPIK LNDVPVDWKS RDLSYLIKDN    360
YEKYFAEIVK KATPVHGENV VLKAHDIEGD VRIEYKDQSH FEIIARQFGI FNEWKDGIPR    420
TAYKGVVVFR YQTPRRIFLV GPDSLRQLGI KDP*                                480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02514GT13_GLCNAC-TI5.0e-172122444328+
pfam03071GNT-I026452433+
Gene Ontology
GO TermDescription
GO:0000139Golgi membrane
GO:0003827alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity
GO:0006487protein N-linked glycosylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAC80697.10164529445N-acetylglucosaminyltransferase I [Solanum tuberosum]
EMBLCAC80700.10104521443N-acetylglucosaminyltransferase I [Arabidopsis thaliana]
EMBLCAC80702.10154528445N-acetylglucosaminyltransferase I [Nicotiana tabacum]
EMBLCBI29533.10144505438unnamed protein product [Vitis vinifera]
RefSeqNP_195537.20104521443CGL1 (COMPLEX GLYCAN LESS 1); alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase/ protein N-acetylglucosaminyltransferase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1foa_A01114445339A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I
PDB1fo9_A01114445339A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I
PDB2apc_A01144442333A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I
PDB2am5_A01144442333A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I
PDB2am4_A01144442333A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I
Transmembrane Domains
StartEnd
1936
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EH7311532911614510
ES8416563171374500
GO802527324383600
EY672091290393220
GT0474703051304340
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00911.3Aquca_007_00911.4Aquca_007_00911.2Aquca_007_00911.1Aquca_007_00911.5
Arabidopsis lyrata912565490588
Arabidopsis thalianaAT4G38240.1AT4G38240.2AT4G38240.3
Brachypodium distachyonBradi3g60820.3Bradi3g60820.1Bradi3g60820.2
Brassica rapaBra033557
Carica papayaevm.TU.contig_28580.1.22.235evm.TU.contig_28580.1.235.387evm.TU.contig_28580.1.235.387evm.TU.contig_28580.1.22.235
Capsella rubellaCarubv10007540m
Citrus clementinaCiclev10028418m
Citrus sinensisorange1.1g019888morange1.1g012941m
Cucumis sativusCucsa.099720.1Cucsa.099720.2
Eucalyptus grandisEucgr.L00584.1Eucgr.L00583.1Eucgr.H04987.1Eucgr.H04987.2Eucgr.H04989.3
Eucgr.H04989.2Eucgr.H04989.4Eucgr.H04989.1
Fragaria vescamrna17328.1-v1.0-hybrid
Glycine maxGlyma04g00200.1Glyma06g00230.1
Gossypium raimondiiGorai.008G014000.2Gorai.008G014000.3Gorai.008G014000.1
Linum usitatissimumLus10022994Lus10001389
Malus domesticaMDP0000173465.283.435MDP0000170967.230.351MDP0000170967.22.209MDP0000170967.22.209MDP0000173465.283.435
MDP0000173465.22.268MDP0000173465.22.268MDP0000170967.230.351
Manihot esculentacassava4.1_024783m
Medicago truncatulaMedtr3g118520.1Medtr3g118520.2Medtr3g118520.3
Mimulus guttatusmgv1a006517mmgv1a006750m
Oryza sativaLOC_Os02g58590.1.304.426LOC_Os02g58590.1.304.426LOC_Os02g58590.1.22.283LOC_Os02g58590.1.22.283
Panicum virgatumPavirv00053907mPavirv00020030m
Physcomitrella patensPp1s100_54V6.1Pp1s246_61V6.1
Phaseolus vulgarisPhvul.009G115600.1
Picea abiesMA_901813g0010
Populus trichocarpaPotri.009G168000.2Potri.009G168000.1Potri.009G168000.4Potri.004G206900.3Potri.004G206900.1
Potri.004G206900.2Potri.009G168000.3
Prunus persicappa006221m
Ricinus communis29675.m000398.22.23129675.m000398.232.34829675.m000398.232.34829675.m000398.22.231
Setaria italicaSi006441mSi006440m
Selaginella moellendorffii268301
Sorghum bicolorSb08g003660.1
Thellungiella halophilaThhalv10025211mThhalv10025208mThhalv10025250m
Vitis viniferaGSVIVT01002028001GSVIVT01002907001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny