y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCitrus sinensis
Cazyme IDorange1.1g014357m
FamilyGT77
Protein PropertiesLength: 427 Molecular Weight: 48219.4 Isoelectric Point: 8.6643
ChromosomeChromosome/Scaffold: 00002 Start: 2792503 End: 2795073
DescriptionNucleotide-diphospho-sugar transferase family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT771814010
  ITNYLVVALDDQTAEYCKTNDIPVYQRDPDEGIDSIARKGGNHAVSGLKFRVLREFLQLDYSVLLSDIDIVFLQNPFEYLYRDSDVESMTDGHNNMTAYG
  YNDVFDEPAMGWARYAHTMRIWVFNSGFFYIRPTIPSIELLDRVADRLGKEKAWDQAVFNEELFFPSHPGYYGLHASKRVMDFYLFMNSKVLFKTVRKDA
  NLKKLKPVVVHVNYHPDKFPR
Full Sequence
Protein Sequence     Length: 427     Download
MAGRREKVQS IRGSRIAIAI VIGVLVGCVF AFLFPHGFFS SNLPIQDRQL VKKNVQAGSS    60
CESPERVNML KSDIASLTEK NAELQKQVRQ LTAKLRLAEQ GKDQAQKQVM VLGEQHKVGP    120
FGTVKALRTN PTVVPDESVN PRLAKILEEV AVGKELIVAL ANSNVKSMLE VWSTNIKRVG    180
ITNYLVVALD DQTAEYCKTN DIPVYQRDPD EGIDSIARKG GNHAVSGLKF RVLREFLQLD    240
YSVLLSDIDI VFLQNPFEYL YRDSDVESMT DGHNNMTAYG YNDVFDEPAM GWARYAHTMR    300
IWVFNSGFFY IRPTIPSIEL LDRVADRLGK EKAWDQAVFN EELFFPSHPG YYGLHASKRV    360
MDFYLFMNSK VLFKTVRKDA NLKKLKPVVV HVNYHPDKFP RMLAIVEFYV NGKQDALDGF    420
PVGSDW*                                                              480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans2.0e-52181398225+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABK94035.103642544435unknown [Populus trichocarpa]
EMBLCBI19661.1014261434unnamed protein product [Vitis vinifera]
RefSeqXP_002283221.1014261434PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002313061.103642544435predicted protein [Populus trichocarpa]
RefSeqXP_002510353.1034265430conserved hypothetical protein [Ricinus communis]
Transmembrane Domains
StartEnd
1335
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EY8586132791123900
EX2681363081214270
EY8174302671614270
DC9010082471814270
GO8485352981284250
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00429.1
Arabidopsis lyrata476651472163476650
Arabidopsis thalianaAT1G19360.1AT1G75120.1AT1G75110.1
Brachypodium distachyonBradi1g15990.1Bradi1g23050.1
Brassica rapaBra016507Bra025734
Carica papayaevm.model.supercontig_62.116evm.model.supercontig_64.63
Capsella rubellaCarubv10021612mCarubv10011112mCarubv10020421mCarubv10021694m
Chlamydomonas reinhardtiiCre12.g552400.t1.3Cre10.g418300.t1.2g11937.t1Cre06.g288500.t1.2Cre02.g111000.t1.2
Citrus clementinaCiclev10001254m
Cucumis sativusCucsa.342160.1Cucsa.240290.1
Eucalyptus grandisEucgr.I01250.1Eucgr.I01251.1Eucgr.I01249.1Eucgr.F01547.1
Fragaria vescamrna02178.1-v1.0-hybridmrna15113.1-v1.0-hybrid
Glycine maxGlyma11g12750.1Glyma14g08280.1Glyma12g04930.1Glyma17g36770.2
Gossypium raimondiiGorai.012G146400.1Gorai.012G146400.2Gorai.010G011500.1
Linum usitatissimumLus10026327Lus10032710Lus10042340Lus10018812
Malus domesticaMDP0000152163MDP0000259542MDP0000518381MDP0000208242MDP0000314698
MDP0000242848
Manihot esculentacassava4.1_007950mcassava4.1_008109m
Mimulus guttatusmgv1a006896mmgv1a006728mmgv1a006960m
Oryza sativaLOC_Os07g39840.1
Panicum virgatumPavirv00016039mPavirv00037224mPavirv00044239mPavirv00031762m
Physcomitrella patensPp1s246_43V6.1Pp1s351_31V6.1
Phaseolus vulgarisPhvul.001G015800.1Phvul.011G047000.1
Picea abiesMA_54369g0010
Populus trichocarpaPotri.014G042700.1Potri.014G042700.2Potri.014G042700.3Potri.002G134400.1Potri.009G113300.1
Prunus persicappa006072mppa005997m
Ricinus communis30170.m01400629851.m002438
Setaria italicaSi029932mSi035830m
Selaginella moellendorffii103279431230
Sorghum bicolorSb02g037900.1Sb01g031700.1
Thellungiella halophilaThhalv10007712mThhalv10018600m
Vitis viniferaGSVIVT01009666001GSVIVT01031309001
Volvox carteriVocar20009953mVocar20009597mVocar20012076m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny