y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCitrus sinensis
Cazyme IDorange1.1g021054m
FamilyGT77
Protein PropertiesLength: 319 Molecular Weight: 36140.3 Isoelectric Point: 8.4061
ChromosomeChromosome/Scaffold: 00001 Start: 2430939 End: 2433844
DescriptionNucleotide-diphospho-sugar transferase family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT771212862.39622e-43
  QDQVLVIAEDYATLYKVNGRWPGHAVLVPPAPDSQTAHKFGSQGFFNFTSRRPCHLLHILELGYNVMYNDVDMVWLKDPFPYLQGDHDVYFTDDMAAVKP
  LDHSHDLPPPGKKGRTYICSCMIYLRPTDGAKLVMKKWIEELQAEPWSKAKKANDQPAFNWALNKT
Full Sequence
Protein Sequence     Length: 319     Download
MSQWLHQRPL HNPLPNPYPL SPRNSMTFQF QRPMLLVLNR TTLLVLLSLL VVLGVILPWT    60
GTPGFMFPNA TSSLAKWRDY TLSQAASFVA KNGTIIVCAV SQPYLPFLNN WLISISRQKH    120
QDQVLVIAED YATLYKVNGR WPGHAVLVPP APDSQTAHKF GSQGFFNFTS RRPCHLLHIL    180
ELGYNVMYND VDMVWLKDPF PYLQGDHDVY FTDDMAAVKP LDHSHDLPPP GKKGRTYICS    240
CMIYLRPTDG AKLVMKKWIE ELQAEPWSKA KKANDQPAFN WALNKTAGQV CSVCLCCHCQ    300
NEIMMLVLCF LVLIEIIL*                                                 360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans1.0e-35119288172+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAK43874.1032965297AF370497_1 unknown protein [Arabidopsis thaliana]
EMBLCAN69309.10502901241hypothetical protein [Vitis vinifera]
RefSeqNP_567211.1032965297unknown protein [Arabidopsis thaliana]
RefSeqXP_002279469.101429020293PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002511939.1012901288conserved hypothetical protein [Ricinus communis]
Transmembrane Domains
StartEnd
3658
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY29448329012900
FC87960128712870
DY26803628912890
FC914138233582900
DY264723233582900
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_074_00044.1
Arabidopsis lyrata352664892838490401474813912111
Arabidopsis thalianaAT4G01220.1AT1G56550.1AT4G01750.1AT4G01220.2AT4G01770.1
Brachypodium distachyonBradi2g26850.1
Brassica rapaBra035432Bra036306Bra000906Bra039864Bra017900
Bra037377Bra000950Bra035431Bra000907
Carica papayaevm.model.supercontig_184.13
Capsella rubellaCarubv10001259mCarubv10001249mCarubv10021691m
Citrus clementinaCiclev10020808mCiclev10022071mCiclev10021218m
Citrus sinensisorange1.1g018302morange1.1g027009m
Cucumis sativusCucsa.135840.2Cucsa.135840.1
Eucalyptus grandisEucgr.E00084.1
Fragaria vescamrna09360.1-v1.0-hybrid
Glycine maxGlyma08g09360.1
Gossypium raimondiiGorai.004G154200.4Gorai.007G104400.1Gorai.004G154200.1Gorai.004G154200.5Gorai.004G154200.3
Gorai.004G154200.2
Linum usitatissimumLus10002153Lus10012650Lus10008735
Malus domesticaMDP0000150593MDP0000264889
Manihot esculentacassava4.1_010616mcassava4.1_010633m
Mimulus guttatusmgv1a008876m
Oryza sativaLOC_Os05g32120.1
Panicum virgatumPavirv00063401mPavirv00048789m
Physcomitrella patensPp1s19_296V6.1
Phaseolus vulgarisPhvul.002G188500.1
Picea abiesMA_10233136g0010MA_173768g0010
Populus trichocarpaPotri.014G092400.2Potri.002G166000.1Potri.014G092400.1
Prunus persicappa007793m
Ricinus communis30174.m008682
Setaria italicaSi022588mSi017632m
Selaginella moellendorffii87970
Sorghum bicolorSb09g019070.1
Thellungiella halophilaThhalv10029467mThhalv10015591mThhalv10024021mThhalv10024115mThhalv10028748m
Vitis viniferaGSVIVT01016220001GSVIVT01027019001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny