y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCitrus sinensis
Cazyme IDorange1.1g027009m
FamilyGT77
Protein PropertiesLength: 230 Molecular Weight: 26135.3 Isoelectric Point: 8.6389
ChromosomeChromosome/Scaffold: 00001 Start: 2430939 End: 2433844
DescriptionNucleotide-diphospho-sugar transferase family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT771212164.6e-28
  QDQVLVIAEDYATLYKVNGRWPGHAVLVPPAPDSQTAHKFGSQGFFNFTSRRPCHLLHILELGYNVMYNDVDMVWLKDPFPYLQGDHDVYFTDDMA
Full Sequence
Protein Sequence     Length: 230     Download
MSQWLHQRPL HNPLPNPYPL SPRNSMTFQF QRPMLLVLNR TTLLVLLSLL VVLGVILPWT    60
GTPGFMFPNA TSSLAKWRDY TLSQAASFVA KNGTIIVCAV SQPYLPFLNN WLISISRQKH    120
QDQVLVIAED YATLYKVNGR WPGHAVLVPP APDSQTAHKF GSQGFFNFTS RRPCHLLHIL    180
ELGYNVMYND VDMVWLKDPF PYLQGDHDVY FTDDMAAVRT LYSMTLELV*               240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans9.0e-2211921599+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN69309.10502211172hypothetical protein [Vitis vinifera]
EMBLCBI31422.106322110361194unnamed protein product [Vitis vinifera]
RefSeqXP_002273155.106222164223PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002279469.101422120224PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002511939.1012211219conserved hypothetical protein [Ricinus communis]
Transmembrane Domains
StartEnd
3658
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FC91434322112210
FC89667622112210
FC90547322112210
DY27577422112210
FC90858222112210
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_074_00044.1
Arabidopsis lyrata352664892838490401474813912111
Arabidopsis thalianaAT4G01220.1AT1G56550.1AT4G01750.1AT4G01220.2AT4G01770.1
Brachypodium distachyonBradi2g26850.1
Brassica rapaBra035432Bra036306Bra000906Bra039864Bra017900
Bra037377Bra000950Bra035431Bra000907
Carica papayaevm.model.supercontig_184.13
Capsella rubellaCarubv10001259mCarubv10001249mCarubv10021691m
Citrus clementinaCiclev10020808mCiclev10022071mCiclev10021218m
Citrus sinensisorange1.1g018302morange1.1g021054m
Cucumis sativusCucsa.135840.2Cucsa.135840.1
Eucalyptus grandisEucgr.E00084.1
Fragaria vescamrna09360.1-v1.0-hybrid
Glycine maxGlyma08g09360.1
Gossypium raimondiiGorai.004G154200.4Gorai.007G104400.1Gorai.004G154200.1Gorai.004G154200.5Gorai.004G154200.3
Gorai.004G154200.2
Linum usitatissimumLus10002153Lus10012650Lus10008735
Malus domesticaMDP0000150593MDP0000264889
Manihot esculentacassava4.1_010616mcassava4.1_010633m
Mimulus guttatusmgv1a008876m
Oryza sativaLOC_Os05g32120.1
Panicum virgatumPavirv00063401mPavirv00048789m
Physcomitrella patensPp1s19_296V6.1
Phaseolus vulgarisPhvul.002G188500.1
Picea abiesMA_10233136g0010MA_173768g0010
Populus trichocarpaPotri.014G092400.2Potri.002G166000.1Potri.014G092400.1
Prunus persicappa007793m
Ricinus communis30174.m008682
Setaria italicaSi022588mSi017632m
Selaginella moellendorffii87970
Sorghum bicolorSb09g019070.1
Thellungiella halophilaThhalv10029467mThhalv10015591mThhalv10024021mThhalv10024115mThhalv10028748m
Vitis viniferaGSVIVT01016220001GSVIVT01027019001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny