y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCitrus sinensis
Cazyme IDorange1.1g036925m
FamilyGT77
Protein PropertiesLength: 640 Molecular Weight: 73242.1 Isoelectric Point: 6.9155
ChromosomeChromosome/Scaffold: 00015 Start: 62896 End: 67945
Descriptionxyloglucanase 113
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT771543780
  LSNILVGALDTKLVKALYWKGVPVFDMGSHMSTMDVGWGSPTFHKMGREKAILIDSVLPFGFELLMCDTDMVWLKNPLPYFARYPDADILTSSDQVVPTV
  VDDRLDIWQQVGAAYNVGIFHWRPTESAKKFAKEWKEMILADDKIWDQNGFNELIRRQLGPSVSEDSELVYAYDGNLKLGVLPASIFCSGHTYFVQAMYK
  QLRLEPYAVHTTFQYAGTEGKRHRL
Full Sequence
Protein Sequence     Length: 640     Download
MGGWRNWYQE LVNSKPLFLT IYTTVIVGIV FSSFYVFSAV YSPSSASANW FSSPPSISHS    60
PVAASSYINV APNFSPTLKV SAIPPPLPQS SSKQVKPIWE VPQTKRLPSL KSFQLTKELV    120
EQRVQDNIII MTFGNYAFMD FILNWVQRLT DLGLSNILVG ALDTKLVKAL YWKGVPVFDM    180
GSHMSTMDVG WGSPTFHKMG REKAILIDSV LPFGFELLMC DTDMVWLKNP LPYFARYPDA    240
DILTSSDQVV PTVVDDRLDI WQQVGAAYNV GIFHWRPTES AKKFAKEWKE MILADDKIWD    300
QNGFNELIRR QLGPSVSEDS ELVYAYDGNL KLGVLPASIF CSGHTYFVQA MYKQLRLEPY    360
AVHTTFQYAG TEGKRHRLRE AMVFYDPPEY YDTPGGFLSF KPFIPKSLLL DGKHDLESHF    420
ALVNYQMKQI RTALAIASVL NRTLVMPPLW CRLDRLWFPH PGVLEGTMTR QPFLCPLDHV    480
FEVNVMLQQL PEDEYGPGIG FREYSFMDNP SVPKQVKESR LEVQLCDDTL IDCQASSNTS    540
SPGILRFPRH SSEETFKTVF SSFKDVKVIN FSSMKNAFLN FTDKTREERF RRRVKRYVGI    600
WCCVDSHTPG HIYYDMYWDE KPDWKPIPPQ TPGDDHLPW*                          660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans2.0e-48154378231+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI29197.109563998642unnamed protein product [Vitis vinifera]
RefSeqNP_850250.1036384643unknown protein [Arabidopsis thaliana]
RefSeqXP_002269181.1095639167711PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002328759.10463915638predicted protein [Populus trichocarpa]
RefSeqXP_002519934.1016391639reticulon3-A3, putative [Ricinus communis]
Transmembrane Domains
StartEnd
1739
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EV2351133011924920
DT5119933041284310
EX1308722951974910
GR7084012981404370
CX6411522683486150
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00317.5Aquca_011_00317.4Aquca_011_00317.3Aquca_011_00317.2Aquca_011_00317.1
Arabidopsis lyrata902666
Arabidopsis thalianaAT2G35610.1
Brachypodium distachyonBradi1g15410.1Bradi3g45950.1
Brassica rapaBra017310Bra005325
Carica papayaevm.model.supercontig_90.39
Capsella rubellaCarubv10022808m
Chlamydomonas reinhardtiig13982.t1g15149.t1Cre02.g082950.t1.3Cre01.g000400.t1.2Cre01.g000450.t1.2
g4580.t1Cre07.g340950.t1.3Cre04.g224350.t1.3Cre01.g000500.t1.3Cre09.g416650.t1.2
Cre13.g574100.t1.2Cre13.g574041.t1.1Cre13.g574050.t1.2Cre07.g332500.t1.2
Citrus clementinaCiclev10011269m
Cucumis sativusCucsa.018320.1Cucsa.018320.10Cucsa.018320.3
Eucalyptus grandisEucgr.E01147.2Eucgr.E01147.1
Fragaria vescamrna10921.1-v1.0-hybrid
Glycine maxGlyma11g09650.2Glyma01g35690.1Glyma16g08350.1Glyma16g20730.1Glyma16g08350.3
Glyma16g08350.2
Gossypium raimondiiGorai.004G177500.4Gorai.008G219000.2Gorai.004G177500.5Gorai.004G177500.6Gorai.004G177500.7
Gorai.004G177500.9Gorai.004G177500.2Gorai.004G177500.3Gorai.004G177500.1Gorai.008G219000.1
Gorai.004G177500.8
Linum usitatissimumLus10005034Lus10027804
Malus domesticaMDP0000349223
Manihot esculentacassava4.1_003398mcassava4.1_008884m
Medicago truncatulaMedtr8g072310.1Medtr5g025590.1
Mimulus guttatusmgv1a002766m
Oryza sativaLOC_Os03g38930.1
Panicum virgatumPavirv00057126mPavirv00045617mPavirv00069114m
Physcomitrella patensPp1s46_165V6.1
Phaseolus vulgarisPhvul.003G278500.1Phvul.002G122000.1
Picea abiesMA_486176g0010MA_10433213g0010
Populus trichocarpaPotri.004G235800.1Potri.004G235800.2
Prunus persicappa002815m
Ricinus communis29827.m002651
Setaria italicaSi034728m
Selaginella moellendorffii127789
Sorghum bicolorSb01g015590.1
Thellungiella halophilaThhalv10016368m
Vitis viniferaGSVIVT01036881001
Volvox carteriVocar20007251mVocar20009385mVocar20010418mVocar20002020mVocar20004159m
Vocar20001219mVocar20001335mVocar20001723mVocar20006862mVocar20009663m
Vocar20008350mVocar20001348m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)