y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCitrus sinensis
Cazyme IDorange1.1g043225m
FamilyGT77
Protein PropertiesLength: 474 Molecular Weight: 53861 Isoelectric Point: 9.1783
ChromosomeChromosome/Scaffold: 00003 Start: 1502796 End: 1505005
DescriptionNucleotide-diphospho-sugar transferase family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT772214410
  VTNFVVCALDYETYQFSILQGLPVFNDPSAPSNISFNDCHFGTKCFQRVTKAKSRMVLQILKLGYNVLLSDVDVYWFKNPLPSLYTYGPFVLAAQSDEYK
  ATGAINLPRRLNSGFYFARSDSSTIAAMEKVVEHAATSGLSEQPSFYDTLCGAGGSNRKGDDRCIEPETNLTVHFLDRNLFPNGAYLGLWQKKNVRRDCA
  KKGCLVLHNNWISGRLKKLER
Full Sequence
Protein Sequence     Length: 474     Download
MLLAWNSVEL PLHNGVLPPF LYGKGIHNQW VISEALSCQQ RFVFDASWTI SSLFFNDPEN    60
LSNQSGKESQ LSGAERRSWE SVGNSRLGSL YGSSFFLEVN YSGLANLVKC DRQYLFVNTT    120
ENIVYPVTYE RLSFWKGQIF HSWRLKKLMA CVGGLKLLHR RLDCCLADQL KALPPLDFPF    180
SLESLLSVIA DKNKTVVLAV AGYSYREMLM SWVCRLRRLR VTNFVVCALD YETYQFSILQ    240
GLPVFNDPSA PSNISFNDCH FGTKCFQRVT KAKSRMVLQI LKLGYNVLLS DVDVYWFKNP    300
LPSLYTYGPF VLAAQSDEYK ATGAINLPRR LNSGFYFARS DSSTIAAMEK VVEHAATSGL    360
SEQPSFYDTL CGAGGSNRKG DDRCIEPETN LTVHFLDRNL FPNGAYLGLW QKKNVRRDCA    420
KKGCLVLHNN WISGRLKKLE RQVLSGLWEY DAGTRMCMQR WDRTKLTKPT RIF*          480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans9.0e-53221442223+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAG52325.10145892535AC011663_4 hypothetical protein; 72471-70598 [Arabidopsis thaliana]
EMBLCAN65937.10146786543hypothetical protein [Vitis vinifera]
RefSeqNP_177220.20145894537unknown protein [Arabidopsis thaliana]
RefSeqXP_002271910.10147193564PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002312675.10146093552predicted protein [Populus trichocarpa]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EY704387277543300
EY7854102631243820
EY7863562251243480
EL3424482662094740
EX1364523091034100
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_094_00019.1Aquca_094_00019.2Aquca_094_00019.3Aquca_094_00019.4
Arabidopsis lyrata476193
Arabidopsis thalianaAT1G70630.1
Brachypodium distachyonBradi2g19997.1
Brassica rapaBra016198
Carica papayaevm.model.supercontig_33.19
Capsella rubellaCarubv10019952mCarubv10020113m
Citrus clementinaCiclev10033870m
Cucumis sativusCucsa.286480.1
Eucalyptus grandisEucgr.B03287.1
Glycine maxGlyma18g20856.1Glyma08g38866.1
Gossypium raimondiiGorai.005G178600.1Gorai.005G178600.2
Linum usitatissimumLus10036860Lus10006212
Malus domesticaMDP0000300726
Manihot esculentacassava4.1_024537m
Medicago truncatulaMedtr8g069400.1
Mimulus guttatusmgv1a025056mmgv1a022943m
Oryza sativaLOC_Os05g43810.1
Panicum virgatumPavirv00043566mPavirv00008500m
Physcomitrella patensPp1s151_80V6.1Pp1s21_134V6.1
Phaseolus vulgarisPhvul.003G065100.1
Picea abiesMA_10426353g0010
Populus trichocarpaPotri.008G186800.1
Prunus persicappa019665m
Ricinus communis27504.m000645
Selaginella moellendorffii76356
Sorghum bicolorSb09g025390.1
Thellungiella halophilaThhalv10018343m
Vitis viniferaGSVIVT01005754001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny